PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT22515
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 352aa    MW: 38272.3 Da    PI: 7.2748
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT22515genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.23e-32201258259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               +Dgy+WrKYGqK vk+s++prsYYrCt+++C vkk+vers +dp++v++tYeg+H+h+
  EMT22515 201 EDGYRWRKYGQKAVKNSPYPRSYYRCTTPKCGVKKRVERSYQDPSTVITTYEGQHTHH 258
               8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.7E-34187260IPR003657WRKY domain
SuperFamilySSF1182907.06E-29193260IPR003657WRKY domain
PROSITE profilePS5081131.066195260IPR003657WRKY domain
SMARTSM007741.6E-37200259IPR003657WRKY domain
PfamPF031062.0E-25201258IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MSSGGGGGGD QGRHGLYHQH GHGQLTRYDG AGGYELSNDD MESFFFNQPE GVGGGPEGVG  60
GGVRADEIAP YSSITSYLQG FLDPTGLARH LDVPAKHELS VDVRSHDQES QGTGSAAGES  120
AALLTPNSSV SFSSGGGDGE GKSRRSNKGR AQEADDQEDG KDHEDGESSK TANNKPKKKA  180
EKRLRLPRVS FLTKSEVDHL EDGYRWRKYG QKAVKNSPYP RSYYRCTTPK CGVKKRVERS  240
YQDPSTVITT YEGQHTHHSP ASLRGSAAHL FMPPGFHGLP PPHLMPPGVF HPELMSMMRM  300
PYPSPNMHLL SVPPPPHHHP TSHPMAGTLQ QHYFTDYALL QDLSPSTMPN NP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-291932611078Probable WRKY transcription factor 4
2lex_A2e-291932611078Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00168DAPTransfer from AT1G29860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6654510.0EU665451.1 Triticum aestivum WRKY36 transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969225.11e-130PREDICTED: probable WRKY transcription factor 71
TrEMBLM8BC860.0M8BC86_AEGTA; Putative WRKY transcription factor 71
STRINGSi002019m1e-130(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.11e-47WRKY DNA-binding protein 71